Antibodies

Jump to Filters
View as table Download
IL24 Rabbit Polyclonal Antibody
TA308643

USD 415.00

In Stock

Rabbit polyclonal antibody to Interleukin-24 (interleukin 24)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 142 and 206 of IL24 (Uniprot ID#Q13007)
IL24 Rabbit Polyclonal Antibody
TA590359

USD 409.00

In Stock

Rabbit Polyclonal Interleukin-24 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the C Terminus Region
IL24 Rabbit Polyclonal Antibody
TA337584

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL24 antibody is: synthetic peptide directed towards the C-terminal region of IL24. Synthetic peptide located within the following region: STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALT