Antibodies

Jump to Filters
View as table Download
Ccdc167 Rabbit Polyclonal Antibody
TA332167

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ccdc167 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-1110021J02Rik Antibody is: synthetic peptide directed towards the middle region of Mouse 1110021J02Rik. Synthetic peptide located within the following region: MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLE