Rabbit polyclonal CEBP Delta antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to the amino terminus of mouse C/EBP. |
Rabbit polyclonal anti-CEBPE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEBPE. |
Rabbit polyclonal CEBPD Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CEBPD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 169-197 amino acids from the C-terminal region of human CEBPD. |
CEBPD (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 10-39 amino acids from the N-terminal region of human CEBPD |
Rabbit polyclonal Rat Cebpd Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Rat Cebpd antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-189 amino acids from the Central region of rat Cebpd. |
Rabbit Polyclonal Anti-CEBPD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CEBPD antibody: synthetic peptide directed towards the middle region of human CEBPD. Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG |
Anti-CEBPD Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta |
Anti-CEBPD Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta |
CEBPD Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CEBPD |
CEBPD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-269 of human CEBPD (NP_005186.2). |
| Modifications | Unmodified |
CEBPD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-269 of human CEBPD (NP_005186.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
