CEBPD Rabbit Polyclonal Antibody

CAT#: TA343515

Rabbit Polyclonal Anti-CEBPD Antibody

Product Images

WB Suggested Anti-CEBPD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate; CEBPD is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CEBPD antibody: synthetic peptide directed towards the middle region of human CEBPD. Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: CCAAT/enhancer binding protein delta
• Database Link:
  NP_005186
  Entrez Gene 1052 Human
  UniProt ID P49716
• Background: CEBPD is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inf
• Synonyms: C; CELF; CRP3; EBP-delta; NF-IL6-beta
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors