Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-MNDA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MNDA. |
Rabbit Polyclonal Anti-MNDA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MNDA Antibody: synthetic peptide directed towards the C terminal of human MNDA. Synthetic peptide located within the following region: KCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN |
MNDA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MNDA |
