MNDA Rabbit Polyclonal Antibody

CAT#: TA335830

Rabbit Polyclonal Anti-MNDA Antibody

Product Images

WB Suggested Anti-MNDA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MNDA Antibody: synthetic peptide directed towards the C terminal of human MNDA. Synthetic peptide located within the following region: KCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: myeloid cell nuclear differentiation antigen
• Database Link:
  NP_002423
  Entrez Gene 4332 Human
  UniProt ID P41218
• Background: The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage.MNDA may act as a transcriptional activator/repressor in the myeloid lineage. It plays a role in the granulocyte/monocyte cell-specific response to interferon. MNDA stimulates the DNA binding of the transcriptional repressor protein YY1.The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage. A 200-amino acid region of human MNDA is strikingly similar to a region in the proteins encoded by a family of interferon-inducible mouse genes, designated Ifi-201, Ifi-202, and Ifi-203, that are not regulated in a cell- or tissue-specific fashion. The 1.8-kb MNDA mRNA, which contains an interferon-stimulated response element in the 5-prime untranslated region, was significantly upregulated in human monocytes exposed to interferon alpha. MNDA is located within 2,200 kb of FCER1A, APCS, CRP, and SPTA1. In its pattern of expression and/or regulation, MNDA resembles IFI16, suggesting that these genes participate in blood cell-specific responses to interferons. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: PYHIN3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors