Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TFB2M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFB2M antibody: synthetic peptide directed towards the N terminal of human TFB2M. Synthetic peptide located within the following region: MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQ |
Rabbit Polyclonal Anti-TFB2M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFB2M antibody: synthetic peptide directed towards the C terminal of human TFB2M. Synthetic peptide located within the following region: ATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKD |
Rabbit Polyclonal Anti-TFB2M Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFB2M Antibody: synthetic peptide directed towards the N terminal of human TFB2M. Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD |
Goat Anti-Tfb2m Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RNLVRDLLEHQNPS, from the internal region of the protein sequence according to NP_032275.2. |
Goat Anti-TFB2M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KHCFGRRSATVIDH, from the internal region of the protein sequence according to NP_071761.1. |
TFB2M rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TFB2M |