Antibodies

Jump to Filters
View as table Download
TSPAN1 Rabbit Polyclonal Antibody
TA307931

USD 415.00

5 Days

Rabbit polyclonal antibody to Tetraspan 1 (tetraspanin 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 132 and 227 of Tetraspan 1 (Uniprot ID#O60635)
TSPAN1 Rabbit Polyclonal Antibody
TA307929

USD 415.00

5 Days

Rabbit polyclonal antibody to tetraspan 1 (tetraspanin 1)

Applications WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 76 and 168 of Tetraspan 1 (Uniprot ID#O60635)
TSPAN1 Rabbit Polyclonal Antibody
TA332053

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSPAN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSPAN1 Antibody: synthetic peptide directed towards the middle region of human TSPAN1. Synthetic peptide located within the following region: TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA