Rabbit Polyclonal Anti-ZNF447 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF447 Antibody: synthetic peptide directed towards the middle region of human ZNF447. Synthetic peptide located within the following region: GDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQRQSVIQQPAP |
Rabbit Polyclonal Anti-ZNF447 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF447 Antibody: synthetic peptide directed towards the N terminal of human ZNF447. Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL |
Germany
Japan
United Kingdom
China