ZNF447 (ZSCAN18) Rabbit Polyclonal Antibody

CAT#: TA333689

Rabbit Polyclonal Anti-ZNF447 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZSCAN18"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF447 Antibody: synthetic peptide directed towards the N terminal of human ZNF447. Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name zinc finger and SCAN domain containing 18
Background ZNF447 contains 1 SCAN box domain and 2 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Synonyms ZNF447
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 85%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.