Antibodies

Jump to Filters
View as table Download
DcR1 (TNFRSF10C) Rabbit Polyclonal Antibody
TA326943

USD 275.00

3 Weeks

TNFRSF10C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFRSF10C
DcR1 (TNFRSF10C) Rabbit Polyclonal Antibody
TA306012

USD 430.00

5 Days

Rabbit Polyclonal DcR1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DcR1 antibody was raised against a peptide corresponding to amino acids in a extracellular domain (ED) of human DcR1 precursor.
DcR1 (TNFRSF10C) Rabbit Polyclonal Antibody
TA306046

USD 430.00

5 Days

Rabbit Polyclonal DcR1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DcR1 antibody was raised against a peptide corresponding to amino acids in the extracellular domain of human DcR1 precursor.
DcR1 (TNFRSF10C) Rabbit Polyclonal Antibody
TA330335

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFRSF10C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF10C antibody: synthetic peptide directed towards the N terminal of human TNFRSF10C. Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG