Antibodies

Jump to Filters
View as table Download
G protein alpha 16 (GNA15) Rabbit Polyclonal Antibody
TA318890

USD 365.00

3 Weeks

Rabbit polyclonal anti-Ga15/16 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 356of human G 15
G protein alpha 16 (GNA15) Rabbit Polyclonal Antibody
TA344323

USD 475.00

In Stock

Rabbit Polyclonal Anti-GNA15 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15. Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG