Antibodies

View as table Download

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2

Rabbit Monoclonal antibody against NR5A2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Anti-NR5A2 / LRH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDYDRSPFVTSPIS, from the internal region of the protein sequence according to NP_995582.1; NP_003813.1.

Rabbit Polyclonal Anti-NR5A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A2 antibody: synthetic peptide directed towards the middle region of human NR5A2. Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS

Rabbit Polyclonal Anti-NR5A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A2 antibody: synthetic peptide directed towards the N terminal of human NR5A2. Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY

Carrier-free (BSA/glycerol-free) NR5A2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR5A2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR5A2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated