Antibodies

View as table Download

Rabbit Polyclonal Anti-ETS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the N terminal of human ETS2. Synthetic peptide located within the following region: NDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQE

Rabbit Polyclonal Anti-ETS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the middle region of human ETS2. Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC

Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ETS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ETS2

ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated