Rabbit Polyclonal SCF Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF. |
Rabbit Polyclonal SCF Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF. |
Rabbit Polyclonal Anti-SCF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCF Antibody: Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF. |
Rabbit Polyclonal Antibody against KITLG (C-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG). |
Anti-Human SCF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human SCF |
Anti-Human SCF Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human SCF |
Anti-KITLG Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF. |
Biotinylated Anti-Human SCF Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human SCF |
Biotinylated Anti-Human SCF Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human SCF |
Rabbit Polyclonal Anti-KITLG Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG |
Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |