Antibodies

View as table Download

Rabbit Polyclonal BAP31 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAP31 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human BAP31.

Rabbit Polyclonal BAP31 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAP31 antibody was raised against a 17 amino acid peptide from near the center of human BAP31.

Goat Polyclonal Antibody against BCAP31

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAAVDGPMDKKEE, from the C Terminus of the protein sequence according to NP_005736.3.

Rabbit polyclonal BCAP31 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This BCAP31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-147 amino acids from the Central region of human BCAP31.

Rabbit Polyclonal Anti-BCAP31 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BCAP31 antibody: synthetic peptide directed towards the middle region of human BCAP31. Synthetic peptide located within the following region: STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Rabbit Polyclonal Anti-BCAP31 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAP31

BCAP31 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BCAP31

BCAP31 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BCAP31

BCAP31 Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BCAP31

BAP31 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 127-246 of human BAP31 (NP_001243376.1).
Modifications Unmodified