Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CD248 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cd248 antibody is: synthetic peptide directed towards the middle region of Mouse Cd248. Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF |
Carrier-free (BSA/glycerol-free) CD248 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD248 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CD248 |
CD248 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1). |
| Modifications | Unmodified |
CD248 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1). |
| Modifications | Unmodified |
CD248 mouse monoclonal antibody,clone OTI1H6
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD248 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD248 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".