Antibodies

View as table Download

Rabbit Polyclonal Anti-COPS3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COPS3 Antibody: A synthesized peptide derived from human COPS3

Rabbit polyclonal anti-JAB1 / COPS3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human JAB1.

Goat Anti-COPS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SLYKKNIQRLT, from the internal region of the protein sequence according to NP_003644.2.

Rabbit Polyclonal Anti-COPS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COPS3 antibody is: synthetic peptide directed towards the C-terminal region of Human COPS3. Synthetic peptide located within the following region: HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS

Rabbit Polyclonal Anti-COPS3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cops3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cops3. Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD

Carrier-free (BSA/glycerol-free) COPS3 mouse monoclonal antibody,clone OTI3E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

COPS3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human COPS3

COPS3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human COPS3

COPS3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 194-423 of human COPS3 (NP_003644.2).
Modifications Unmodified

COPS3 mouse monoclonal antibody,clone OTI3E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated