DUSP5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DUSP5 |
DUSP5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DUSP5 |
Rabbit Polyclonal Anti-DUSP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID |
Rabbit Polyclonal Anti-DUSP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS |
Carrier-free (BSA/glycerol-free) DUSP5 mouse monoclonal antibody,clone OTI5H9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP5 mouse monoclonal antibody,clone OTI8E12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP5 mouse monoclonal antibody,clone OTI2F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP5 mouse monoclonal antibody,clone OTI5D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP5 mouse monoclonal antibody,clone OTI1G2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP5 mouse monoclonal antibody,clone OTI1D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP5 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DUSP5 |
DUSP5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 315-384 of human DUSP5 (NP_004410.3). |
Modifications | Unmodified |
DUSP5 mouse monoclonal antibody,clone OTI5H9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP5 mouse monoclonal antibody,clone OTI5H9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DUSP5 mouse monoclonal antibody,clone OTI8E12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP5 mouse monoclonal antibody,clone OTI8E12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DUSP5 mouse monoclonal antibody,clone OTI2F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP5 mouse monoclonal antibody,clone OTI2F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DUSP5 mouse monoclonal antibody,clone OTI5D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP5 mouse monoclonal antibody,clone OTI5D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DUSP5 mouse monoclonal antibody,clone OTI1G2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP5 mouse monoclonal antibody,clone OTI1G2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DUSP5 mouse monoclonal antibody,clone OTI1D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP5 mouse monoclonal antibody,clone OTI1D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".