Antibodies

View as table Download

Rabbit Polyclonal Anti-GABA(A) alpha4 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSKDEKLSPENFTR(C), corresponding to amino acid residues 37-50 of rat GABA(A) a4 with replacement of C44 with serine. Extracellular, N-terminus.

Rabbit polyclonal anti-GABRA4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GABRA4.

Goat Anti-GABRA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKAKRKTSKPPQE, from the internal region of the protein sequence according to NP_000800.2.

Rabbit Polyclonal Anti-GABRA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA4 antibody: synthetic peptide directed towards the N terminal of human GABRA4. Synthetic peptide located within the following region: MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR

GABRA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 36-258 of human GABRA4 (NP_000800.2).
Modifications Unmodified