Rabbit polyclonal hnRNP C1/C2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2. |
Rabbit polyclonal hnRNP C1/C2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2. |
Rabbit polyclonal antibody to hnRNP C1/C2 (heterogeneous nuclear ribonucleoprotein C (C1/C2))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 142 of hnRNP C1/C2 |
Rabbit Polyclonal Anti-HNRPC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPC antibody: synthetic peptide directed towards the N terminal of human HNRPC. Synthetic peptide located within the following region: LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ |
Rabbit Polyclonal Anti-HNRNPC Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRNPC antibody: synthetic peptide directed towards the middle region of human HNRNPC. Synthetic peptide located within the following region: ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN |
Rabbit Polyclonal Anti-hnRNP C1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-hnRNP C1/2 Antibody: A synthesized peptide derived from human hnRNP C1/2 |
HNRNPC rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPC |
Rabbit Polyclonal hnRNP C1/2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human hnRNP C1/2 |
Rabbit Polyclonal hnRNP C1/2 (Ser260) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human hnRNP C1/2 around the phosphorylation site of Serine 260 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HNRNPC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HNRNPC antibody is: synthetic peptide directed towards the C-terminal region of Human HNRNPC. Synthetic peptide located within the following region: ADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS |
Rabbit Polyclonal Anti-HNRNPC Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HNRNPC antibody is: synthetic peptide directed towards the middle region of Human HNRNPC. Synthetic peptide located within the following region: VDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGG |
Rabbit Polyclonal Anti-CYP20A1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPC |
Hnrnpc Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
hnRNP C Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human hnRNP C |
Modifications | Unmodified |