HNRNPC Rabbit Polyclonal Antibody

CAT#: TA343944

Rabbit Polyclonal Anti-HNRPC Antibody

Product Images

WB Suggested Anti-HNRPC Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateHNRNPC is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRPC antibody: synthetic peptide directed towards the N terminal of human HNRPC. Synthetic peptide located within the following region: LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein C (C1/C2)
• Database Link:
  NP_112604
  Entrez Gene 3183 Human
  UniProt ID P07910
• Background: HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has one RRM domain that binds to RNAs. Two alternatively spliced transcript variants have been described for this gene.
• Synonyms: C1; C2; HNRNP; HNRPC; SNRPC
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%

Reference Data

• Protein Pathways: Spliceosome