Antibodies

Jump to Filters
View as table Download
LIF Rabbit Polyclonal Antibody
TA319675

USD 430.00

5 Days

Rabbit Polyclonal LIF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIF antibody was raised against a 16 amino acid synthetic peptide near the center of human LIF.
LIF Rat Monoclonal Antibody [Clone ID: 39N7D10]
TA337172

USD 424.00

5 Days

Rat Monoclonal LIF Antibody (39N7D10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
LIF Rabbit Polyclonal Antibody
TA319047

USD 355.00

3 Weeks

Rabbit polyclonal anti-leukemia inhibitory factor (LIF) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human LIF
LIF Rabbit Polyclonal Antibody
TA335060

USD 375.00

5 Days

Rabbit Polyclonal Anti-LIF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIF antibody: synthetic peptide directed towards the N terminal of human LIF. Synthetic peptide located within the following region: KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ
LIF Rabbit Polyclonal Antibody
TA321468

USD 345.00

4 Weeks

Anti-LIF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human leukemia inhibitory factor
LIF Rabbit Polyclonal Antibody
TA378033

USD 220.00

3 Weeks

LIF Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-202 of human LIF (NP_002300.1).
Modifications Unmodified
LIF Rabbit Polyclonal Antibody
TA384664

USD 380.00

4 Weeks

LIF Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the C-terminal region of human LIF. AA range:141-190