Antibodies

View as table Download

Rabbit polyclonal Mst1/2 (Phospho-Thr183) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Mst1/2 around the phosphorylation site of threonine 183 (R-N-TP-V-I).
Modifications Phospho-specific

Rabbit polyclonal Mst1/2 (Ab-183) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Mst1/Mst2 around the phosphorylation site of threonine 183 (R-N-TP-V-I).

Rabbit Polyclonal MST1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Anti-MST1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MST1 antibody: synthetic peptide directed towards the middle region of human MST1. Synthetic peptide located within the following region: SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE

Rabbit Polyclonal Anti-MST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MST1. Synthetic peptide located within the following region: TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC

Carrier-free (BSA/glycerol-free) MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated