Antibodies

View as table Download

Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P).

Rabbit Polyclonal NGFI-B alpha/Nur77/NR4A1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a synthetic peptide corresponding to aa 251-266 of human Nak1 (NP_775180).

Rabbit polyclonal Nuclear Receptor NR4A1 (Ser351)(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P).
Modifications Phospho-specific

Rabbit Polyclonal Anti-NR4A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the N terminal of human NR4A1. Synthetic peptide located within the following region: GTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMD

Rabbit Polyclonal Anti-NR4A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the N terminal of human NR4A1. Synthetic peptide located within the following region: GTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMD

Rabbit Polyclonal Anti-NR4A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the C terminal of human NR4A1. Synthetic peptide located within the following region: RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF

Rabbit Polyclonal Anti-NR4A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the middle region of human NR4A1. Synthetic peptide located within the following region: FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL

Goat Polyclonal Antibody against NR4A1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GRLPSKPKQPPDAS, from the internal region of the protein sequence according to NP_002126.2; NP_775180.1.

Rabbit Polyclonal Anti-NR4A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR4A1 antibody is: synthetic peptide directed towards the C-terminal region of Human NR4A1. Synthetic peptide located within the following region: DSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIAS

Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR4A1 / NUR77 antibody was raised against synthetic 15 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster (100%); Marmoset, Elephant, Panda, Bovine, Dog, Horse (93%); Bat, Rabbit (87%).

Rabbit Polyclonal Anti-NR4A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR4A1

NUR77 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NUR77 (NP_775180.1).
Modifications Unmodified

NUR77 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NUR77 (NP_775180.1).
Modifications Unmodified

NUR77 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human NUR77