NUR77 (NR4A1) Rabbit Polyclonal Antibody

CAT#: TA330634

Rabbit Polyclonal Anti-NR4A1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NR4A1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the C terminal of human NR4A1. Synthetic peptide located within the following region: RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 64 kDa
Gene Name nuclear receptor subfamily 4 group A member 1
Background NR4A1 encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis.
Synonyms GFRP1; HMR; N10; NAK-1; NGFIB; NP10; NUR77; TR3
Note Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways MAPK signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.