SOX9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SOX9 |
SOX9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SOX9 |
Rabbit Polyclonal Anti-SOX9 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal SOX9 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SOX9 |
Rabbit Polyclonal SOX9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Feline, Goat, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody. |
SOX9 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SOX9 |
Rabbit Polyclonal SOX-9 (Ser181) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SOX-9 around the phosphorylation site of Serine 181 |
Modifications | Phospho-specific |
Rabbit anti SOX-9 (pS181) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding the epitope –RKSVK- with a single phosphorylation site Ser181. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Rabbit anti SOX-9 (paired S181) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding the epitope –RKSVK- without phosphorylation. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Rabbit Polyclonal Anti-SOX9 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the N terminal of human SOX9. Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG |
Rabbit anti SOX-9 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from internal sequence of Human SOX-9 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Carrier-free (BSA/glycerol-free) SOX9 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SOX9 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SOX9 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SOX9 |
SOX9 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SOX9 (NP_000337.1). |
Modifications | Unmodified |
SOX9 Rabbit monoclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
SOX9 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX9 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX9 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX9 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX9 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX9 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |