Rabbit Polyclonal Anti-GIPC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GIPC1 antibody: synthetic peptide directed towards the N terminal of human GIPC1. Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA |
Goat Polyclonal Antibody against GIPC1 / NIP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GAIGDAKVGRY, from the C Terminus of the protein sequence according to NP_005707.1; NP_974197.1; NP_974199.1; NP_974196.1; NP_974198.1; NP_974223.1. |
Germany
Japan
United Kingdom
China
