GIPC (GIPC1) Rabbit Polyclonal Antibody

CAT#: TA345929

Rabbit Polyclonal Anti-GIPC1 Antibody

Product Images

WB Suggested Anti-GIPC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GIPC1 antibody: synthetic peptide directed towards the N terminal of human GIPC1. Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: GIPC PDZ domain containing family member 1
• Database Link:
  NP_974199
  Entrez Gene 10755 Human
  UniProt ID O14908
• Background: GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.
• Synonyms: C19orf3; GIPC; GLUT1CBP; Hs.6454; IIP-1; NIP; RGS19IP1; SEMCAP; SYNECTIIN; SYNECTIN; TIP-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome