Rabbit polyclonal anti-CEP55 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEP55. |
Rabbit polyclonal anti-CEP55 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEP55. |
CEP55 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human CEP55 |
Rabbit Polyclonal Anti-CEP55 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the middle region of human CEP55. Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL |
Rabbit Polyclonal Anti-CEP55 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the N terminal of human CEP55. Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK |
Carrier-free (BSA/glycerol-free) CEP55 mouse monoclonal antibody,clone OTI6H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CEP55 mouse monoclonal antibody,clone OTI10C4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CEP55 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CEP55 |
CEP55 mouse monoclonal antibody,clone OTI6H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CEP55 mouse monoclonal antibody,clone OTI6H3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CEP55 mouse monoclonal antibody,clone OTI6H3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CEP55 mouse monoclonal antibody,clone OTI6H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CEP55 mouse monoclonal antibody,clone OTI10C4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CEP55 mouse monoclonal antibody,clone OTI10C4, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CEP55 mouse monoclonal antibody,clone OTI10C4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CEP55 mouse monoclonal antibody,clone OTI10C4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |