Antibodies

View as table Download

Rabbit Polyclonal Anti-GTF2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD

Rabbit Polyclonal Anti-GTF2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), Biotinylated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated