Rabbit Polyclonal Anti-ADAMTS15 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADAMTS15 |
Rabbit Polyclonal Anti-ADAMTS15 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADAMTS15 |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AGXT2L2 |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the C terminal of human AGXT2L2. Synthetic peptide located within the following region: KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLS |
Rabbit Polyclonal Anti-AGXT2L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the N terminal of human AGXT2L2. Synthetic peptide located within the following region: QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRL |