Rabbit polyclonal anti-GPR34 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR34. |
Rabbit polyclonal anti-GPR34 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR34. |
GPR34 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 239-269aa) of human GPR34. |
Rabbit Polyclonal Anti-GPR34 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: KGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNL |
Rabbit Polyclonal Anti-GPR34 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH |
Rabbit Polyclonal Anti-GPR34 Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | GPR34 antibody was raised against synthetic 17 amino acid peptide from 2nd cytoplasmic domain of human GPR34. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Bovine, Horse (100%); Marmoset, Mouse, Rat, Elephant, Guinea pig (94%); Panda (88%); Bat, Opossum (82%). |