Antibodies

View as table Download

Goat Anti-CLIC1 / NCC27 (aa45-57) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TVDTKRRTETVQK, from the internal region of the protein sequence according to NP_001279.2.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF

Goat Anti-CLIC1 / NCC27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TEVHTDTNKIEE, from the internal region of the protein sequence according to NP_001279.2.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CLIC1