Antibodies

View as table Download

Rabbit polyclonal anti-NOX5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5.

Goat Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EWHPFTISSAPEQKD, from the internal region of the protein sequence according to NP_078781.3; NP_001171708.1; NP_001171709.1.

Rabbit Polyclonal Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human NOX5. Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG

Rabbit Polyclonal Anti-NOX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NOX5