Antibodies

View as table Download

Rabbit polyclonal anti-CYP4V2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CYP4V2.

Rabbit polyclonal Anti-CYP4V2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4V2 antibody: synthetic peptide directed towards the middle region of human CYP4V2. Synthetic peptide located within the following region: RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI

Mouse monoclonal Anti-Cytochrome P450 4V2 Clone M29-P3B10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated