CYP4V2 Rabbit Polyclonal Antibody

CAT#: TA335104

Rabbit polyclonal Anti-CYP4V2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CYP4V2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CYP4V2 antibody: synthetic peptide directed towards the middle region of human CYP4V2. Synthetic peptide located within the following region: RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 61 kDa
Gene Name cytochrome P450 family 4 subfamily V member 2
Background CYP4V2 may have a role in fatty acid and steroid metabolism.This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms BCD; CYP4AH1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Horse: 92%; Mouse: 92%; Bovine: 85%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome, P450, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.