Antibodies

Jump to Filters
View as table Download
CYP51A1 Rabbit Polyclonal Antibody
TA342862

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP51A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP51A1 antibody: synthetic peptide directed towards the N terminal of human CYP51A1. Synthetic peptide located within the following region: TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ
CYP51A1 Mouse Monoclonal Antibody [Clone ID: N6-P2H5*G8]
TA353141L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Cytochrome P450 51A1 Clone N6-P2H5*G8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated