Antibodies

Jump to Filters
View as table Download
PR3 (PRTN3) Goat Polyclonal Antibody
TA326729

USD 375.00

5 Days

Goat Anti-proteinase 3 / myeloblastin (aa88-98) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HNVRTQEPTQQ, from the internal region of the protein sequence according to NP_002768.3.
PR3 (PRTN3) Rabbit Polyclonal Antibody
TA343123

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRTN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRTN3 antibody: synthetic peptide directed towards the N terminal of human PRTN3. Synthetic peptide located within the following region: IPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLS