PR3 (PRTN3) Rabbit Polyclonal Antibody

CAT#: TA343123

Rabbit Polyclonal Anti-PRTN3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PRTN3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PRTN3 antibody: synthetic peptide directed towards the N terminal of human PRTN3. Synthetic peptide located within the following region: IPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 28 kDa
Gene Name proteinase 3
Background PRTN3 is a polymorphonuclear leukocyte serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) and causes emphysema when administered by tracheal insufflation to hamsters.
Synonyms ACPA; AGP7; C-ANCA; CANCA; MBN; MBT; NP-4; NP4; P29; PR-3; PR3
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Protease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.