Antibodies

View as table Download

Rabbit polyclonal anti-USP13 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human USP13.

Rabbit Polyclonal Anti-USP13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP13 antibody: synthetic peptide directed towards the N terminal of human USP13. Synthetic peptide located within the following region: TIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK

Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)

Applications IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)

Applications IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11), Biotinylated

Applications IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11), HRP conjugated

Applications IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)

Applications IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated