Rabbit polyclonal anti-USP13 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human USP13. |
Rabbit polyclonal anti-USP13 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human USP13. |
Rabbit Polyclonal Anti-USP13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP13 antibody: synthetic peptide directed towards the N terminal of human USP13. Synthetic peptide located within the following region: TIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK |
Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
Anti-USP13 mouse monoclonal antibody, clone OTI4G11 (formerly 4G11)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-USP13 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), Biotinylated
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), HRP conjugated
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-USP13 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |