Rabbit Polyclonal Anti-EDN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EDN2 antibody: synthetic peptide directed towards the n terminal of human EDN2. Synthetic peptide located within the following region: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS |
Anti-EDN2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-178 amino acids of human endothelin 2 |
Rabbit Polyclonal Anti-EDN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EDN2 |
Germany
Japan
United Kingdom
China