Antibodies

View as table Download

Rabbit Polyclonal Anti-MATN2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MATN2 antibody: synthetic peptide directed towards the middle region of human MATN2. Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Rabbit Polyclonal MATN2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MATN2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human MATN2.

Rabbit polyclonal MATN2 Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MATN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 732-760 amino acids from the C-terminal region of human MATN2.