Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-VASH1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VASH1 |
Rabbit polyclonal anti-VASH1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human VASH1. |
Rabbit Polyclonal Anti-VASH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VASH1 antibody: synthetic peptide directed towards the N terminal of human VASH1. Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER |
Rabbit Polyclonal Anti-VASH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VASH1 antibody: synthetic peptide directed towards the middle region of human VASH1. Synthetic peptide located within the following region: SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA |
