Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
| Modifications | Phospho-specific |
MCM3 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM3 |
Rabbit Polyclonal Anti-MCM3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE |
Rabbit Polyclonal Anti-MCM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK |
Anti-MCM3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human minichromosome maintenance complex component 3 |
Germany
Japan
United Kingdom
China
