Antibodies

View as table Download

Rabbit Polyclonal NSD3 Antibody

Applications WB
Reactivities Bovine, Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to a internal portion of the human protein (within residues 300-400). [Swiss-Prot# Q9BZ95]

Rabbit anti-WHSC1L1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WHSC1L1

Rabbit Polyclonal Anti-Wipf1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wipf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Wipf1. Synthetic peptide located within the following region: MPVPPPPAPPPPPTFALANTEKPSLNKTEQAGRNALLSDISKGKKLKKTV

NSD3 (WHSC1L1) (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 195-225 amino acids from the N-terminal region of human WHSC1L1

Goat Polyclonal Antibody against SETMAR

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RWQKCVDCNGSYFD, from the C Terminus of the protein sequence according to NP_006506.

Rabbit polyclonal anti-SETMAR antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SETMAR.

Rabbit Polyclonal Anti-WHSC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG

Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI1F11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI6A12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI3G3

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) WHSC1L1 mouse monoclonal antibody,clone OTI3B3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

WHSC1L1 mouse monoclonal antibody,clone OTI1F11

Applications WB
Reactivities Human
Conjugation Unconjugated

WHSC1L1 mouse monoclonal antibody,clone OTI1F11

Applications WB
Reactivities Human
Conjugation Unconjugated

WHSC1L1 mouse monoclonal antibody,clone OTI3G3

Applications IHC
Reactivities Human
Conjugation Unconjugated

WHSC1L1 mouse monoclonal antibody,clone OTI3G3

Applications IHC
Reactivities Human
Conjugation Unconjugated

WHSC1L1 mouse monoclonal antibody,clone OTI3B3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

WHSC1L1 mouse monoclonal antibody,clone OTI3B3, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

WHSC1L1 mouse monoclonal antibody,clone OTI3B3, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

WHSC1L1 mouse monoclonal antibody,clone OTI3B3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated