Rabbit Polyclonal Anti-FOXP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the C terminal of human FOXP4. Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE |
Rabbit Polyclonal Anti-FOXP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the N terminal of human FOXP4. Synthetic peptide located within the following region: MVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGAD |
Rabbit Polyclonal Anti-FOXP4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-FOXP4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.7~11(S-E-T-I-R) derived from Human FOXP4. |
Rabbit Polyclonal anti-FOXP4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the middle region of human FOXP4. Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE |
Rabbit anti FOXP4 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human FOXP4 protein. This sequence is identical within human, mouse, rat origins. |
Germany
Japan
United Kingdom
China
