Antibodies

Jump to Filters
View as table Download
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
ACSL3 (C-term) Rabbit Polyclonal Antibody
AP50062PU-N

USD 450.00

2 Weeks

ACSL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 527-556 amino acids from the C-terminal region of human ACSL3