Antibodies

View as table Download

GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40.

GPR40 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Tested:
Conjugation Unconjugated
Immunogen FFAR1 / GPR40 antibody was raised against synthetic 19 amino acid peptide from 1st cytoplasmic domain of human GPR40. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Mouse, Hamster, Pig (84%).

GPR40 (FFAR1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide containing a sequence corresponding to a region within amino acids 239 and 300 of Human GPR40

Goat Polyclonal Antibody against GPR40

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1.

Rabbit Polyclonal Anti-FFAR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV

GPR40 (FFAR1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 280-300 amino acids from the C-terminal region of human FFAR1