GPR40 (FFAR1) Rabbit Polyclonal Antibody

CAT#: TA330390

Rabbit Polyclonal Anti-FFAR1 Antibody

Product Images

WB Suggested Anti-FFAR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: free fatty acid receptor 1
• Database Link:
  NP_005294
  Entrez Gene 2864 Human
  UniProt ID O14842
• Background: FFAR1 is receptor for medium and long chain saturated and unsaturated fatty acids. It binding of the ligand increase intracellular calcium concentration and amplify glucose-stimulated insulin secretion. The activity of this receptor is mediated by G-proteins that activate phospholipase C.
• Synonyms: FFA1R; GPCR40; GPR40
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Human: 100%; Pig: 92%; Mouse: 85%; Rat: 85%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane